PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf06486g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TALE
Protein Properties Length: 734aa    MW: 80974.8 Da    PI: 7.2774
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf06486g00002.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.62.5e-095345662254
                               SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                  Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                               ++yp+ +++  LA+++gLt +qV++WF N R +
  Niben101Scf06486g00002.1 534 HPYPTDSDKHMLATQTGLTRNQVSNWFINARVR 566
                               89*****************************87 PP

2BELL104.28.8e-34389455672
                      BELL   6 qkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                                +kkakL+ +++e+++rYkqy++q+q+v+ssFe+vagl +a+pY+slAlk iS+hFr+L++ai++++
  Niben101Scf06486g00002.1 389 LQKKAKLIYMQDEICRRYKQYHQQMQMVVSSFETVAGLSAATPYISLALKSISQHFRSLRNAISDHL 455
                               57*************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.5E-47309453IPR006563POX domain
PfamPF075261.2E-41314452IPR006563POX domain
PROSITE profilePS5007111.823507570IPR001356Homeobox domain
CDDcd000861.62E-11510571No hitNo description
SMARTSM003896.2E-9510574IPR001356Homeobox domain
SuperFamilySSF466898.13E-17512576IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.8E-28513574IPR009057Homeodomain-like
PfamPF059207.3E-18527566IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010223Biological Processsecondary shoot formation
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010229Biological Processinflorescence development
GO:0048645Biological Processorgan formation
GO:0080006Biological Processinternode patterning
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 734 aa     Download sequence    Send to blast
MSHQTSEFHV AQQSRRERLR FNSEQGIQPY QYGNISYDPS VLSTEMFNFG TIMEPVVVSN  60
KDTMMIHNLE LRAASDRLDH GVSHDVTQNC SNWKSIDLQQ TGSCNWNNVG NYSSGSGVVI  120
ESNLSTPMFV GDQGLSGSLN LNNVSTIDVK PNFFDYQEIQ QSPETNSSSN MQYSSTAVLY  180
HDTLQQVVTS ATVGTRGVEM PGCGSWTESG NELLLLPNYV DHSRPLHVKN SSDLVSRPVE  240
RCHDQWISCE LGTNVSINST APDNSQALAL SLSPVPTSKT KMVQMEKRSA LSESFAIAHR  300
SAVPLGPFTG YATILKSSKF LRPAQQLMDE LCNLAAGSNA VKSCIYSKKV HEGGVRVSCD  360
GNAAESSSGA VVGDSGGSSA ESNGRPDYLQ KKAKLIYMQD EICRRYKQYH QQMQMVVSSF  420
ETVAGLSAAT PYISLALKSI SQHFRSLRNA ISDHLKNIRQ ALGEDLPSPA SGMSKGDGTS  480
SKMKFIDRTL HKQKAGGAGV AFFESQQHVW RPQRGLPERA VAILRAWLFD HFLHPYPTDS  540
DKHMLATQTG LTRNQVSNWF INARVRVWKP MVEEIHTLET KGLGDQIGSS ARRSGGKLVT  600
ERPNHVNDGL NRSSISISNC GQHFNVLNMS GMSEKQDDCS GIGPSERLDE EILWKNQEKR  660
SRLECHIPAS MDGSLMGFVP YQRNGLEIGG IGAVSLTLGL RQNAEAAQQQ QLQQLHEHRL  720
RQQFGGQMIH DFVD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A2e-16516573158Homeobox protein Meis1
4xrs_B2e-16516573158Homeobox protein Meis1
5bng_A2e-16516574159Homeobox protein Meis2
5bng_B2e-16516574159Homeobox protein Meis2
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009775317.10.0PREDICTED: BEL1-like homeodomain protein 2
RefseqXP_016443065.10.0PREDICTED: BEL1-like homeodomain protein 2
TrEMBLM1AE490.0M1AE49_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000208250.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA87202227
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27990.12e-85BEL1-like homeodomain 8